PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010099195.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family G2-like
Protein Properties Length: 368aa    MW: 42055.3 Da    PI: 8.2963
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010099195.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.12e-3380133255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     prlrWtp+LH++Fv+ave+LGG+++AtPk +l++m+vkgLt++hvkSHLQ+YR+
  XP_010099195.1  80 PRLRWTPDLHRCFVHAVERLGGEDRATPKMVLQIMDVKGLTISHVKSHLQMYRS 133
                     8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-3276135IPR009057Homeodomain-like
PROSITE profilePS5129411.14476136IPR017930Myb domain
SuperFamilySSF466891.34E-1578134IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-2480134IPR006447Myb domain, plants
PfamPF002493.0E-781132IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MVKGDQSPLN KRSRASSFDN NIGQHMNINI IPESPDCVTR SNSRSSVEGS VDHDDHHNLM  60
MTEISLKSPV VRPYVRSKMP RLRWTPDLHR CFVHAVERLG GEDRATPKMV LQIMDVKGLT  120
ISHVKSHLQM YRSMKHEKLM QEAAMAAKEN EKARAFQHSN YYSSHLDTIN CQQYDYFQDN  180
RCNELVNFSV PYHTYGTCHI DHDQLDLKIN TANIPGVQWK KKQDMWNVEK KVREPLSSEV  240
QSERRKYWEQ KPSSYIIFKN LLKRCTAHHH ELESNIGLKE KESLQNMRAS SSTTTSKSND  300
KEADDKAAPK RVVLDADDAC TVLSLSLNSY NTSGHDQVLW QLSQASSGNS DASNDVSLEL  360
TLAPKSRI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010099195.10.0Putative Myb family transcription factor
TrEMBLW9RHH30.0W9RHH3_9R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF93812840
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.16e-34G2-like family protein